Lineage for d1i9ca_ (1i9c A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2438294Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2439787Superfamily c.23.6: Cobalamin (vitamin B12)-binding domain [52242] (1 family) (S)
  5. 2439788Family c.23.6.1: Cobalamin (vitamin B12)-binding domain [52243] (5 protein domains)
  6. 2439792Protein Glutamate mutase, small subunit [52246] (2 species)
  7. 2439793Species Clostridium cochlearium [TaxId:1494] [52248] (4 PDB entries)
  8. 2439796Domain d1i9ca_: 1i9c A: [71136]
    Other proteins in same PDB: d1i9cb_, d1i9cd_
    complexed with 2as, 5ad, b12, glu

Details for d1i9ca_

PDB Entry: 1i9c (more details), 1.9 Å

PDB Description: glutamate mutase from clostridium cochlearium: complex with adenosylcobalamin and substrate
PDB Compounds: (A:) glutamate mutase

SCOPe Domain Sequences for d1i9ca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i9ca_ c.23.6.1 (A:) Glutamate mutase, small subunit {Clostridium cochlearium [TaxId: 1494]}
mekktivlgvigsdchavgnkildhaftnagfnvvnigvlspqenfikaaietkadailv
sslygqgeidckglrqkcdeaglegillyvggnivvgkqhwpdvekrfkdmgydrvyapg
tppevgiadlkkdlnie

SCOPe Domain Coordinates for d1i9ca_:

Click to download the PDB-style file with coordinates for d1i9ca_.
(The format of our PDB-style files is described here.)

Timeline for d1i9ca_: