Lineage for d1i8kb_ (1i8k B:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1510242Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1510447Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1510801Species Mouse (Mus musculus), cluster 2.2 [TaxId:10090] [88550] (58 PDB entries)
    Uniprot P01811 # HV41_MOUSE (P01811) Ig heavy chain V region UPC10
  8. 1510803Domain d1i8kb_: 1i8k B: [71131]
    Other proteins in same PDB: d1i8ka_
    part of dsFv MR1; complex with a EGFR-VIII peptide
    mutant

Details for d1i8kb_

PDB Entry: 1i8k (more details), 1.8 Å

PDB Description: crystal structure of dsfv mr1 in complex with the peptide antigen of the mutant epidermal growth factor receptor, egfrviii, at liquid nitrogen temperature
PDB Compounds: (B:) epidermal growth factor receptor antibody mr1scfv heavy chain

SCOPe Domain Sequences for d1i8kb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i8kb_ b.1.1.1 (B:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]}
qvklqqsggglvkpgaslklscvtsgftfrkfgmswvrqtsdkclewvasistggyntyy
sdnvkgrftisrenakntlylqmsslksedtalyyctrgysstsyamdywgqgttvtvs

SCOPe Domain Coordinates for d1i8kb_:

Click to download the PDB-style file with coordinates for d1i8kb_.
(The format of our PDB-style files is described here.)

Timeline for d1i8kb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1i8ka_