Lineage for d1i7ga_ (1i7g A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2008478Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2008932Protein Peroxisome proliferator activated receptor alpha, PPAR-alpha [69109] (1 species)
  7. 2008933Species Human (Homo sapiens) [TaxId:9606] [69110] (16 PDB entries)
  8. 2008940Domain d1i7ga_: 1i7g A: [71121]
    complex with the agonist AZ 242
    complexed with az2, cpq, na

Details for d1i7ga_

PDB Entry: 1i7g (more details), 2.2 Å

PDB Description: crystal structure of the ligand binding domain from human ppar-alpha in complex with the agonist az 242
PDB Compounds: (A:) peroxisome proliferator activated receptor alpha

SCOPe Domain Sequences for d1i7ga_:

Sequence, based on SEQRES records: (download)

>d1i7ga_ a.123.1.1 (A:) Peroxisome proliferator activated receptor alpha, PPAR-alpha {Human (Homo sapiens) [TaxId: 9606]}
etadlkslakriyeaylknfnmnkvkarvilsgkasnnppfvihdmetlcmaektlvakl
vangiqnkeaevrifhccqctsvetvteltefakaipgfanldlndqvtllkygvyeaif
amlssvmnkdgmlvaygngfitreflkslrkpfcdimepkfdfamkfnalelddsdislf
vaaiiccgdrpgllnvghiekmqegivhvlrlhlqsnhpddiflfpkllqkmadlrqlvt
ehaqlvqiikktesdaalhpllqeiyrdmy

Sequence, based on observed residues (ATOM records): (download)

>d1i7ga_ a.123.1.1 (A:) Peroxisome proliferator activated receptor alpha, PPAR-alpha {Human (Homo sapiens) [TaxId: 9606]}
etadlkslakriyeaylknfnmnkvkarvilsgsnnppfvihdmetlcmaektlqnkeae
vrifhccqctsvetvteltefakaipgfanldlndqvtllkygvyeaifamlssvmnkdg
mlvaygngfitreflkslrkpfcdimepkfdfamkfnalelddsdislfvaaiiccgdrp
gllnvghiekmqegivhvlrlhlqsnhpddiflfpkllqkmadlrqlvtehaqlvqiikk
tesdaalhpllqeiyrdmy

SCOPe Domain Coordinates for d1i7ga_:

Click to download the PDB-style file with coordinates for d1i7ga_.
(The format of our PDB-style files is described here.)

Timeline for d1i7ga_: