SCOP 1.69: Domain d1i6na_: 1i6n A:

Lineage for d1i6na_ (1i6n A:)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (31 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.15: Xylose isomerase-like [51658] (6 families)
   different families share similar but non-identical metal-binding sites

5. Family c.1.15.4: Hypothetical protein IolI [75090] (1 protein)

6. Protein Hypothetical protein IolI [75091] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [75092] (2 PDB entries)

8. Domain d1i6na_: 1i6n A: [71119]
   Structural genomics

Details for d1i6na_

PDB Entry: 1i6n, 1.8 Å

PDB Description: 1.8 a crystal structure of ioli protein with a binding zinc atom

SCOP Domain Sequences for d1i6na_:

Sequence; same for both SEQRES and ATOM records:

>d1i6na_ c.1.15.4 (A:) Hypothetical protein IolI {Bacillus subtilis}
mklcfneattlensnlkldlelcekhgydyieirtmdklpeylkdhslddlaeyfqthhi
kplalnalvffnnrdekghneiitefkgmmetcktlgvkyvvavplvteqkivkeeikks
svdvltelsdiaepygvkialefvghpqctvntfeqayeivntvnrdnvglvldsfhfha
mgsnieslkqadgkkifiyhiddtedfpigfltdedrvwpgqgaidldahlsalkeigfs
dvvsvelfrpeyykltaeeaiqtakkttvdvvskyfsm

Timeline for d1i6na_:

• d1i6na_ first appeared in SCOP 1.61
  
• d1i6na_ appears in SCOP 1.67
  
• d1i6na_ appears in SCOP 1.71
  
• d1i6na_ appears in the current release, SCOPe 2.08