Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.15: Xylose isomerase-like [51658] (5 families) different families share similar but non-identical metal-binding sites |
Family c.1.15.4: Hypothetical protein IolI [75090] (1 protein) |
Protein Hypothetical protein IolI [75091] (1 species) |
Species Bacillus subtilis [TaxId:1423] [75092] (2 PDB entries) |
Domain d1i60a_: 1i60 A: [71118] structural genomics protein; complexed with mse |
PDB Entry: 1i60 (more details), 1.6 Å
SCOP Domain Sequences for d1i60a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i60a_ c.1.15.4 (A:) Hypothetical protein IolI {Bacillus subtilis} mklcfneattlensnlkldlelcekhgydyieirtmdklpeylkdhslddlaeyfqthhi kplalnalvffnnrdekghneiitefkgmmetcktlgvkyvvavplvteqkivkeeikks svdvltelsdiaepygvkialefvghpqctvntfeqayeivntvnrdnvglvldsfhfha mgsnieslkqadgkkifiyhiddtedfpigfltdedrvwpgqgaidldahlsalkeigfs dvvsvelfrpeyykltaeeaiqtakkttvdvvskyfsm
Timeline for d1i60a_: