Lineage for d1i60a_ (1i60 A:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 235645Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 237768Superfamily c.1.15: Xylose isomerase-like [51658] (5 families) (S)
    different families share similar but non-identical metal-binding sites
  5. 237951Family c.1.15.4: Hypothetical protein IolI [75090] (1 protein)
  6. 237952Protein Hypothetical protein IolI [75091] (1 species)
  7. 237953Species Bacillus subtilis [TaxId:1423] [75092] (2 PDB entries)
  8. 237954Domain d1i60a_: 1i60 A: [71118]
    structural genomics protein; complexed with mse

Details for d1i60a_

PDB Entry: 1i60 (more details), 1.6 Å

PDB Description: structural genomics, ioli protein

SCOP Domain Sequences for d1i60a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i60a_ c.1.15.4 (A:) Hypothetical protein IolI {Bacillus subtilis}
mklcfneattlensnlkldlelcekhgydyieirtmdklpeylkdhslddlaeyfqthhi
kplalnalvffnnrdekghneiitefkgmmetcktlgvkyvvavplvteqkivkeeikks
svdvltelsdiaepygvkialefvghpqctvntfeqayeivntvnrdnvglvldsfhfha
mgsnieslkqadgkkifiyhiddtedfpigfltdedrvwpgqgaidldahlsalkeigfs
dvvsvelfrpeyykltaeeaiqtakkttvdvvskyfsm

SCOP Domain Coordinates for d1i60a_:

Click to download the PDB-style file with coordinates for d1i60a_.
(The format of our PDB-style files is described here.)

Timeline for d1i60a_: