Lineage for d1i5eb_ (1i5e B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2143900Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2143901Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 2143902Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins)
  6. 2144182Protein Uracil PRTase, Upp [53293] (5 species)
  7. 2144183Species Bacillus caldolyticus [TaxId:1394] [75256] (1 PDB entry)
  8. 2144185Domain d1i5eb_: 1i5e B: [71117]
    complexed with u5p

Details for d1i5eb_

PDB Entry: 1i5e (more details), 3 Å

PDB Description: crystal structure of bacillus caldolyticus uracil phosphoribosyltransferase with bound ump
PDB Compounds: (B:) uracil phosphoribosyltransferase

SCOPe Domain Sequences for d1i5eb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i5eb_ c.61.1.1 (B:) Uracil PRTase, Upp {Bacillus caldolyticus [TaxId: 1394]}
gkvyvfdhpliqhkltyirdkntgtkefrelvdevatlmafeitrdlpleeveietpvsk
arakviagkklgvipilragigmvdgilklipaakvghiglyrdpqtlkpveyyvklpsd
veerdfiivdpmlatggsavaaidalkkrgaksikfmcliaapegvkavetahpdvdiyi
aalderlndhgyivpglgdagdrlfgtk

SCOPe Domain Coordinates for d1i5eb_:

Click to download the PDB-style file with coordinates for d1i5eb_.
(The format of our PDB-style files is described here.)

Timeline for d1i5eb_: