![]() | Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
![]() | Fold c.61: PRTase-like [53270] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
![]() | Superfamily c.61.1: PRTase-like [53271] (2 families) ![]() |
![]() | Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (9 proteins) |
![]() | Protein Uracil PRTase [53293] (3 species) |
![]() | Species Bacillus caldolyticus [TaxId:1394] [75256] (1 PDB entry) |
![]() | Domain d1i5eb_: 1i5e B: [71117] complexed with u5p |
PDB Entry: 1i5e (more details), 3 Å
SCOP Domain Sequences for d1i5eb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i5eb_ c.61.1.1 (B:) Uracil PRTase {Bacillus caldolyticus} gkvyvfdhpliqhkltyirdkntgtkefrelvdevatlmafeitrdlpleeveietpvsk arakviagkklgvipilragigmvdgilklipaakvghiglyrdpqtlkpveyyvklpsd veerdfiivdpmlatggsavaaidalkkrgaksikfmcliaapegvkavetahpdvdiyi aalderlndhgyivpglgdagdrlfgtk
Timeline for d1i5eb_: