Lineage for d1i5ea_ (1i5e A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2499119Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2499120Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 2499121Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins)
  6. 2499444Protein Uracil PRTase, Upp [53293] (5 species)
  7. 2499445Species Bacillus caldolyticus [TaxId:1394] [75256] (1 PDB entry)
  8. 2499446Domain d1i5ea_: 1i5e A: [71116]
    complexed with u5p

Details for d1i5ea_

PDB Entry: 1i5e (more details), 3 Å

PDB Description: crystal structure of bacillus caldolyticus uracil phosphoribosyltransferase with bound ump
PDB Compounds: (A:) uracil phosphoribosyltransferase

SCOPe Domain Sequences for d1i5ea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i5ea_ c.61.1.1 (A:) Uracil PRTase, Upp {Bacillus caldolyticus [TaxId: 1394]}
gkvyvfdhpliqhkltyirdkntgtkefrelvdevatlmafeitrdlpleeveietpvsk
arakviagkklgvipilragigmvdgilklipaakvghiglyrdpqtlkpveyyvklpsd
veerdfiivdpmlatggsavaaidalkkrgaksikfmcliaapegvkavetahpdvdiyi
aalderlndhgyivpglgdagdrlfgtk

SCOPe Domain Coordinates for d1i5ea_:

Click to download the PDB-style file with coordinates for d1i5ea_.
(The format of our PDB-style files is described here.)

Timeline for d1i5ea_: