Lineage for d1i5ea_ (1i5e A:)
- Root: SCOP 1.61
Class c: Alpha and beta proteins (a/b) [51349] (117 folds) 
Fold c.61: PRTase-like [53270] (1 superfamily) Superfamily c.61.1: PRTase-like [53271] (2 families) 
Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (9 proteins) 
Protein Uracil PRTase [53293] (3 species) 
Species Bacillus caldolyticus [TaxId:1394] [75256] (1 PDB entry) 
Domain d1i5ea_: 1i5e A: [71116]
Details for d1i5ea_
PDB Entry: 1i5e (more details), 3 Å
PDB Description: crystal structure of bacillus caldolyticus uracil phosphoribosyltransferase with bound ump
SCOP Domain Sequences for d1i5ea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i5ea_ c.61.1.1 (A:) Uracil PRTase {Bacillus caldolyticus}
gkvyvfdhpliqhkltyirdkntgtkefrelvdevatlmafeitrdlpleeveietpvsk
arakviagkklgvipilragigmvdgilklipaakvghiglyrdpqtlkpveyyvklpsd
veerdfiivdpmlatggsavaaidalkkrgaksikfmcliaapegvkavetahpdvdiyi
aalderlndhgyivpglgdagdrlfgtk
SCOP Domain Coordinates for d1i5ea_:
Click to download the PDB-style file with coordinates for d1i5ea_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1i5ea_:
- d1i5ea_ is new in SCOP 1.61
- d1i5ea_ appears in SCOP 1.63
- d1i5ea_ appears in the current release, SCOPe 2.08
View in 3D
