Lineage for d1i4nb_ (1i4n B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2079053Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2079565Family c.1.2.4: Tryptophan biosynthesis enzymes [51381] (4 protein domains)
  6. 2079566Protein Indole-3-glycerophosphate synthase, IPGS [51385] (4 species)
  7. 2079577Species Thermotoga maritima [TaxId:2336] [75052] (2 PDB entries)
    TM0140
  8. 2079579Domain d1i4nb_: 1i4n B: [71115]
    complexed with so4

Details for d1i4nb_

PDB Entry: 1i4n (more details), 2.5 Å

PDB Description: crystal structure of indoleglycerol phosphate synthase from thermotoga maritima
PDB Compounds: (B:) indole-3-glycerol phosphate synthase

SCOPe Domain Sequences for d1i4nb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i4nb_ c.1.2.4 (B:) Indole-3-glycerophosphate synthase, IPGS {Thermotoga maritima [TaxId: 2336]}
rrlweiveakkkdileidgenlivqrrnhrflevlsgkervkiiaefkkaspsagdinad
asledfirmydeladaisiltekhyfkgdpafvraarnltcrpilakdfyidtvqvklas
svgadailiiariltaeqikeiyeaaeelgmdslvevhsredlekvfsvirpkiigintr
dldtfeikknvlwellplvpddtvvvaesgikdprelkdlrgkvnavlvgtsimkaenpr
rfleemrawse

SCOPe Domain Coordinates for d1i4nb_:

Click to download the PDB-style file with coordinates for d1i4nb_.
(The format of our PDB-style files is described here.)

Timeline for d1i4nb_: