Lineage for d1i4na_ (1i4n A:)
- Root: SCOP 1.61
Class c: Alpha and beta proteins (a/b) [51349] (117 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (25 superfamilies) 
Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (4 families) 
Family c.1.2.4: Tryptophan biosynthesis enzymes [51381] (3 proteins) 
Protein Indole-3-glycerophosphate synthase, IPGS [51385] (3 species) 
Species Thermotoga maritima, TM0140 [75052] (2 PDB entries) 
Domain d1i4na_: 1i4n A: [71114]
Details for d1i4na_
PDB Entry: 1i4n (more details), 2.5 Å
PDB Description: crystal structure of indoleglycerol phosphate synthase from thermotoga maritima
SCOP Domain Sequences for d1i4na_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i4na_ c.1.2.4 (A:) Indole-3-glycerophosphate synthase, IPGS {Thermotoga maritima, TM0140}
rrlweiveakkkdileidgenlivqrrnhrflevlsgkervkiiaefkkaspsagdinad
asledfirmydeladaisiltekhyfkgdpafvraarnltcrpilakdfyidtvqvklas
svgadailiiariltaeqikeiyeaaeelgmdslvevhsredlekvfsvirpkiigintr
dldtfeikknvlwellplvpddtvvvaesgikdprelkdlrgkvnavlvgtsimkaenpr
rfleemrawse
SCOP Domain Coordinates for d1i4na_:
Click to download the PDB-style file with coordinates for d1i4na_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1i4na_:
- d1i4na_ is new in SCOP 1.61
- d1i4na_ appears in SCOP 1.63
- d1i4na_ appears in the current release, SCOPe 2.08
View in 3D
