SCOPe 2.04: Domain d1i3cb_: 1i3c B:

Lineage for d1i3cb_ (1i3c B:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.1: CheY-related [52173] (26 proteins)

6. Protein Response regulator for cyanobacterial phytochrome [75152] (3 species)

7. Species Synechocystis sp. PCC 6803, RCP1 [TaxId:1148] [75153] (2 PDB entries)

8. Domain d1i3cb_: 1i3c B: [71113]
   complexed with so4

Details for d1i3cb_

PDB Entry: 1i3c, 1.9 Å

PDB Description: response regulator for cyanobacterial phytochrome, rcp1

PDB Compounds: (B:) response regulator rcp1

SCOPe Domain Sequences for d1i3cb_:

Sequence; same for both SEQRES and ATOM records:

>d1i3cb_ c.23.1.1 (B:) Response regulator for cyanobacterial phytochrome {Synechocystis sp. PCC 6803, RCP1 [TaxId: 1148]}
ppkvillvedskadsrlvqevlktstidheliilrdglaamaflqqqgeyensprpnlil
ldlnlpkkdgrevlaeikqnpdlkripvvvlttshneddviasyelhvncyltksrnlkd
lfkmvqgiesfwletvtlpa

Timeline for d1i3cb_:

• d1i3cb_ first appeared in SCOP 1.61
  
• d1i3cb_ appears in SCOPe 2.03
  
• d1i3cb_ appears in SCOPe 2.05
  
• d1i3cb_ appears in the current release, SCOPe 2.08