SCOPe 2.08: Domain d1i36b2: 1i36 B:1-152

Lineage for d1i36b2 (1i36 B:1-152)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.6: 6-phosphogluconate dehydrogenase-like, N-terminal domain [51868] (19 proteins)
   the beta-sheet is extended to 8 strands, order 32145678; strands 7 & 8 are antiparallel to the rest
   C-terminal domains also show some similarity

6. Protein Conserved hypothetical protein MTH1747 [75113] (1 species)

7. Species Methanobacterium thermoautotrophicum [TaxId:145262] [75114] (1 PDB entry)

8. Domain d1i36b2: 1i36 B:1-152 [71111]
   Other proteins in same PDB: d1i36a1, d1i36b1
   complexed with nap

Details for d1i36b2

PDB Entry: 1i36, 2 Å

PDB Description: structure of conserved protein mth1747 of unknown function reveals structural similarity with 3-hydroxyacid dehydrogenases

PDB Compounds: (B:) conserved hypothetical protein mth1747

SCOPe Domain Sequences for d1i36b2:

Sequence; same for both SEQRES and ATOM records:

>d1i36b2 c.2.1.6 (B:1-152) Conserved hypothetical protein MTH1747 {Methanobacterium thermoautotrophicum [TaxId: 145262]}
lrvgfigfgevaqtlasrlrsrgvevvtslegrspstierartvgvtetseedvyscpvv
isavtpgvalgaarragrhvrgiyvdinnispetvrmassliekggfvdaaimgsvrrkg
adiriiasgrdaeefmklnryglnievrgrep

Timeline for d1i36b2:

• d1i36b2 first appeared in SCOP 1.61
  
• d1i36b2 appears in SCOPe 2.07