Lineage for d1i2ha_ (1i2h A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1323359Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 1323360Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 1323726Family b.55.1.4: Enabled/VASP homology 1 domain (EVH1 domain) [50767] (7 proteins)
  6. 1323743Protein Homer [50774] (2 species)
  7. 1323749Species Norway rat (Rattus norvegicus) [TaxId:10116] [50775] (3 PDB entries)
  8. 1323751Domain d1i2ha_: 1i2h A: [71103]

Details for d1i2ha_

PDB Entry: 1i2h (more details), 1.8 Å

PDB Description: crystal structure analysis of psd-zip45(homer1c/vesl-1l)conserved homer 1 domain
PDB Compounds: (A:) psd-zip45(homer-1c/vesl-1l)

SCOPe Domain Sequences for d1i2ha_:

Sequence, based on SEQRES records: (download)

>d1i2ha_ b.55.1.4 (A:) Homer {Norway rat (Rattus norvegicus) [TaxId: 10116]}
efmgeqpifstrahvfqidpntkknwvptskhavtvsyfydstrnvyriisldgskaiin
stitpnmtftktsqkfgqwadsrantvyglgfssehhlskfaekfqefkeaarlakeksq
ekmeltstpsqesaggdlqspltpe

Sequence, based on observed residues (ATOM records): (download)

>d1i2ha_ b.55.1.4 (A:) Homer {Norway rat (Rattus norvegicus) [TaxId: 10116]}
efmgeqpifstrahvfqidpntkknwvptskhavtvsyfydstrnvyriisldgskaiin
stitpnmtftktsqkfgqwadsrantvyglgfssehhlskfaekfqefkeaarlakeksk
meltstpsgdlqspltpe

SCOPe Domain Coordinates for d1i2ha_:

Click to download the PDB-style file with coordinates for d1i2ha_.
(The format of our PDB-style files is described here.)

Timeline for d1i2ha_: