Lineage for d1i2ha_ (1i2h A:)
- Root: SCOP 1.61
Class b: All beta proteins [48724] (111 folds) 
Fold b.55: PH domain-like [50728] (1 superfamily) Superfamily b.55.1: PH domain-like [50729] (5 families) 
Family b.55.1.4: Enabled/VASP homology 1 domain (EVH1 domain) [50767] (4 proteins) Protein Homer [50774] (2 species) Species Rat (Rattus norvegicus) [TaxId:10116] [50775] (3 PDB entries) 
Domain d1i2ha_: 1i2h A: [71103]
Details for d1i2ha_
PDB Entry: 1i2h (more details), 1.8 Å
PDB Description: crystal structure analysis of psd-zip45(homer1c/vesl-1l)conserved homer 1 domain
SCOP Domain Sequences for d1i2ha_:
Sequence, based on SEQRES records: (download)
>d1i2ha_ b.55.1.4 (A:) Homer {Rat (Rattus norvegicus)}
efmgeqpifstrahvfqidpntkknwvptskhavtvsyfydstrnvyriisldgskaiin
stitpnmtftktsqkfgqwadsrantvyglgfssehhlskfaekfqefkeaarlakeksq
ekmeltstpsqesaggdlqspltpe
Sequence, based on observed residues (ATOM records): (download)
>d1i2ha_ b.55.1.4 (A:) Homer {Rat (Rattus norvegicus)}
efmgeqpifstrahvfqidpntkknwvptskhavtvsyfydstrnvyriisldgskaiin
stitpnmtftktsqkfgqwadsrantvyglgfssehhlskfaekfqefkeaarlakeksk
meltstpsgdlqspltpe
SCOP Domain Coordinates for d1i2ha_:
Click to download the PDB-style file with coordinates for d1i2ha_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1i2ha_:
- d1i2ha_ is new in SCOP 1.61
- d1i2ha_ appears in SCOP 1.63
- d1i2ha_ appears in the current release, SCOPe 2.08, called d1i2ha1
View in 3D