Lineage for d1i2ha1 (1i2h A:1001-1143)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2803065Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2803066Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2803479Family b.55.1.4: Enabled/VASP homology 1 domain (EVH1 domain) [50767] (7 proteins)
  6. 2803496Protein Homer [50774] (2 species)
  7. 2803502Species Norway rat (Rattus norvegicus) [TaxId:10116] [50775] (3 PDB entries)
  8. 2803503Domain d1i2ha1: 1i2h A:1001-1143 [71103]
    Other proteins in same PDB: d1i2ha2

Details for d1i2ha1

PDB Entry: 1i2h (more details), 1.8 Å

PDB Description: crystal structure analysis of psd-zip45(homer1c/vesl-1l)conserved homer 1 domain
PDB Compounds: (A:) psd-zip45(homer-1c/vesl-1l)

SCOPe Domain Sequences for d1i2ha1:

Sequence, based on SEQRES records: (download)

>d1i2ha1 b.55.1.4 (A:1001-1143) Homer {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mgeqpifstrahvfqidpntkknwvptskhavtvsyfydstrnvyriisldgskaiinst
itpnmtftktsqkfgqwadsrantvyglgfssehhlskfaekfqefkeaarlakeksqek
meltstpsqesaggdlqspltpe

Sequence, based on observed residues (ATOM records): (download)

>d1i2ha1 b.55.1.4 (A:1001-1143) Homer {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mgeqpifstrahvfqidpntkknwvptskhavtvsyfydstrnvyriisldgskaiinst
itpnmtftktsqkfgqwadsrantvyglgfssehhlskfaekfqefkeaarlakekskme
ltstpsgdlqspltpe

SCOPe Domain Coordinates for d1i2ha1:

Click to download the PDB-style file with coordinates for d1i2ha1.
(The format of our PDB-style files is described here.)

Timeline for d1i2ha1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1i2ha2