SCOPe 2.05: Domain d1i13a_: 1i13 A:

Lineage for d1i13a_ (1i13 A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (3 families)

5. Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins)

6. Protein Hypoxanthine PRTase [53286] (3 species)

7. Species Trypanosoma cruzi [TaxId:5693] [53287] (9 PDB entries)
   Uniprot Q27796

8. Domain d1i13a_: 1i13 A: [71098]
   complexed with 7hp, fmt, mg, prp; mutant

Details for d1i13a_

PDB Entry: 1i13, 1.84 Å

PDB Description: analysis of an invariant aspartic acid in hprts-alanine mutant

PDB Compounds: (A:) hypoxanthine-guanine phosphoribosyltransferase

SCOPe Domain Sequences for d1i13a_:

Sequence; same for both SEQRES and ATOM records:

>d1i13a_ c.61.1.1 (A:) Hypoxanthine PRTase {Trypanosoma cruzi [TaxId: 5693]}
yefaekilfteeeirtrikevakriaddykgkglrpyvnplvlisvlkgsfmftadlcra
lcdfnvpvrmeficvssygegltssgqvrmlldtrhsieghhvlivedivataltlnyly
hmyftrrpaslktvvlldkregrrvpfsadyvvanipnafvigygldyddtyrelrdivv
lrpevya

Timeline for d1i13a_:

• d1i13a_ first appeared in SCOP 1.61
  
• d1i13a_ appears in SCOPe 2.04
  
• d1i13a_ appears in SCOPe 2.06
  
• d1i13a_ appears in the current release, SCOPe 2.08