Lineage for d1hy3b_ (1hy3 B:)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 313180Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 313181Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (21 families) (S)
    division into families based on beta-sheet topologies
  5. 313455Family c.37.1.5: PAPS sulfotransferase [52575] (5 proteins)
    similar to the nucleotide/nucleoside kinases but transfer sulphate group
  6. 313459Protein Estrogen sulfotransferase [52576] (2 species)
  7. 313460Species Human (Homo sapiens) [TaxId:9606] [75198] (2 PDB entries)
  8. 313464Domain d1hy3b_: 1hy3 B: [71091]
    complexed with pps; mutant

Details for d1hy3b_

PDB Entry: 1hy3 (more details), 1.8 Å

PDB Description: crystal structure of human estrogen sulfotransferase v269e mutant in the presence of paps

SCOP Domain Sequences for d1hy3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hy3b_ c.37.1.5 (B:) Estrogen sulfotransferase {Human (Homo sapiens)}
seldyyekfeevhgilmykdfvkywdnveafqarpddlviatypksgttwvseivymiyk
egdvekckedvifnripflecrkenlmngvkqldemnsprivkthlppellpasfwekdc
kiiylcrnakdvavsfyyfflmvaghpnpgsfpefvekfmqgqvpygswykhvkswwekg
ksprvlflfyedlkedirkeviklihflerkpseelvdriihhtsfqemknnpstnyttl
pdeimnqklspfmrkgitgdwknhftealnekfdkhyeqqmkestlkf

SCOP Domain Coordinates for d1hy3b_:

Click to download the PDB-style file with coordinates for d1hy3b_.
(The format of our PDB-style files is described here.)

Timeline for d1hy3b_: