Class c: Alpha and beta proteins (a/b) [51349] (121 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (21 families) division into families based on beta-sheet topologies |
Family c.37.1.5: PAPS sulfotransferase [52575] (5 proteins) similar to the nucleotide/nucleoside kinases but transfer sulphate group |
Protein Estrogen sulfotransferase [52576] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [75198] (2 PDB entries) |
Domain d1hy3b_: 1hy3 B: [71091] complexed with pps; mutant |
PDB Entry: 1hy3 (more details), 1.8 Å
SCOP Domain Sequences for d1hy3b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hy3b_ c.37.1.5 (B:) Estrogen sulfotransferase {Human (Homo sapiens)} seldyyekfeevhgilmykdfvkywdnveafqarpddlviatypksgttwvseivymiyk egdvekckedvifnripflecrkenlmngvkqldemnsprivkthlppellpasfwekdc kiiylcrnakdvavsfyyfflmvaghpnpgsfpefvekfmqgqvpygswykhvkswwekg ksprvlflfyedlkedirkeviklihflerkpseelvdriihhtsfqemknnpstnyttl pdeimnqklspfmrkgitgdwknhftealnekfdkhyeqqmkestlkf
Timeline for d1hy3b_: