Lineage for d1hy3a_ (1hy3 A:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 179162Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 179163Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (18 families) (S)
  5. 179379Family c.37.1.5: PAPS sulfotransferase [52575] (5 proteins)
  6. 179383Protein Estrogen sulfotransferase [52576] (2 species)
  7. 179384Species Human (Homo sapiens) [TaxId:9606] [75198] (1 PDB entry)
  8. 179385Domain d1hy3a_: 1hy3 A: [71090]

Details for d1hy3a_

PDB Entry: 1hy3 (more details), 1.8 Å

PDB Description: crystal structure of human estrogen sulfotransferase v269e mutant in the presence of paps

SCOP Domain Sequences for d1hy3a_:

Sequence, based on SEQRES records: (download)

>d1hy3a_ c.37.1.5 (A:) Estrogen sulfotransferase {Human (Homo sapiens)}
nseldyyekfeevhgilmykdfvkywdnveafqarpddlviatypksgttwvseivymiy
kegdvekckedvifnripflecrkenlmngvkqldemnsprivkthlppellpasfwekd
ckiiylcrnakdvavsfyyfflmvaghpnpgsfpefvekfmqgqvpygswykhvkswwek
gksprvlflfyedlkedirkeviklihflerkpseelvdriihhtsfqemknnpstnytt
lpdeimnqklspfmrkgitgdwknhftealnekfdkhyeqqmkestlkf

Sequence, based on observed residues (ATOM records): (download)

>d1hy3a_ c.37.1.5 (A:) Estrogen sulfotransferase {Human (Homo sapiens)}
nseldyyekfeevhgilmykdfvkywdnveafqarpddlviatypksgttwvseivymiy
kegdvekckedvifnripflecrkenlmngvkqldemnsprivkthlppellpasfwekd
ckiiylcrnakdvavsfyyfflmvaghpnpgsfpefvekfmqgqvpygswykhvkswwek
gksprvlflfyedlkedirkeviklihflerkpseelvdriihhtsfqemknnpstnytt
lpdeimnqkpfmrkgitgdwknhftealnekfdkhyeqqmkestlkf

SCOP Domain Coordinates for d1hy3a_:

Click to download the PDB-style file with coordinates for d1hy3a_.
(The format of our PDB-style files is described here.)

Timeline for d1hy3a_: