Lineage for d1hxva_ (1hxv A:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 857507Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 857508Superfamily d.26.1: FKBP-like [54534] (3 families) (S)
  5. 857509Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (16 proteins)
  6. 857662Protein Trigger factor PPIase domain [75388] (3 species)
  7. 857668Species Mycoplasma genitalium [TaxId:2097] [75389] (1 PDB entry)
  8. 857669Domain d1hxva_: 1hxv A: [71089]

Details for d1hxva_

PDB Entry: 1hxv (more details)

PDB Description: ppiase domain of the mycoplasma genitalium trigger factor
PDB Compounds: (A:) Trigger Factor

SCOP Domain Sequences for d1hxva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hxva_ d.26.1.1 (A:) Trigger factor PPIase domain {Mycoplasma genitalium [TaxId: 2097]}
klangdiaiidftgivdnkklasasaqnyeltigsnsfikgfetgliamkvnqkktlalt
fpsdyhvkelqskpvtfevvlkaik

SCOP Domain Coordinates for d1hxva_:

Click to download the PDB-style file with coordinates for d1hxva_.
(The format of our PDB-style files is described here.)

Timeline for d1hxva_: