Lineage for d1htwc_ (1htw C:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1362078Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1362079Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1365505Family c.37.1.18: YjeE-like [75213] (1 protein)
    mixed beta-sheet; order 234156(0), strands 2 and 6 are antiparallel to the rest
    automatically mapped to Pfam PF02367
  6. 1365506Protein Hypothetical protein HI0065 [75214] (1 species)
  7. 1365507Species Haemophilus influenzae [TaxId:727] [75215] (2 PDB entries)
  8. 1365510Domain d1htwc_: 1htw C: [71085]
    complexed with ADP and magnesium
    complexed with act, adp, mg, na

Details for d1htwc_

PDB Entry: 1htw (more details), 1.7 Å

PDB Description: complex of hi0065 with adp and magnesium
PDB Compounds: (C:) hi0065

SCOPe Domain Sequences for d1htwc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1htwc_ c.37.1.18 (C:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]}
mesltqyipdefsmlrfgkkfaeillklhtekaimvylngdlgagkttltrgmlqgighq
gnvksptytlveeyniagkmiyhfdlyrladpeelefmgirdyfntdsicliewsekgqg
ilpeadilvnidyyddarnieliaqtnlgkniisafsn

SCOPe Domain Coordinates for d1htwc_:

Click to download the PDB-style file with coordinates for d1htwc_.
(The format of our PDB-style files is described here.)

Timeline for d1htwc_: