Lineage for d1htqu1 (1htq U:1-100)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1017615Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1019029Superfamily d.15.9: Glutamine synthetase, N-terminal domain [54368] (1 family) (S)
  5. 1019030Family d.15.9.1: Glutamine synthetase, N-terminal domain [54369] (1 protein)
  6. 1019031Protein Glutamine synthetase, N-terminal domain [54370] (2 species)
  7. 1019032Species Mycobacterium tuberculosis [TaxId:1773] [75372] (3 PDB entries)
  8. 1019059Domain d1htqu1: 1htq U:1-100 [71075]
    Other proteins in same PDB: d1htqa2, d1htqb2, d1htqc2, d1htqd2, d1htqe2, d1htqf2, d1htqg2, d1htqh2, d1htqi2, d1htqj2, d1htqk2, d1htql2, d1htqm2, d1htqn2, d1htqo2, d1htqp2, d1htqq2, d1htqr2, d1htqs2, d1htqt2, d1htqu2, d1htqv2, d1htqw2, d1htqx2
    complexed with amp, cit, mn

Details for d1htqu1

PDB Entry: 1htq (more details), 2.4 Å

PDB Description: multicopy crystallographic structure of a relaxed glutamine synthetase from mycobacterium tuberculosis
PDB Compounds: (U:) glutamine synthetase

SCOPe Domain Sequences for d1htqu1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1htqu1 d.15.9.1 (U:1-100) Glutamine synthetase, N-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]}
tpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgfqsi
hesdmlllpdpetaridpfraaktlninffvhdpftlepy

SCOPe Domain Coordinates for d1htqu1:

Click to download the PDB-style file with coordinates for d1htqu1.
(The format of our PDB-style files is described here.)

Timeline for d1htqu1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1htqu2
View in 3D
Domains from other chains:
(mouse over for more information)
d1htqa1, d1htqa2, d1htqb1, d1htqb2, d1htqc1, d1htqc2, d1htqd1, d1htqd2, d1htqe1, d1htqe2, d1htqf1, d1htqf2, d1htqg1, d1htqg2, d1htqh1, d1htqh2, d1htqi1, d1htqi2, d1htqj1, d1htqj2, d1htqk1, d1htqk2, d1htql1, d1htql2, d1htqm1, d1htqm2, d1htqn1, d1htqn2, d1htqo1, d1htqo2, d1htqp1, d1htqp2, d1htqq1, d1htqq2, d1htqr1, d1htqr2, d1htqs1, d1htqs2, d1htqt1, d1htqt2, d1htqv1, d1htqv2, d1htqw1, d1htqw2, d1htqx1, d1htqx2