| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.9: Glutamine synthetase, N-terminal domain [54368] (2 families) ![]() automatically mapped to Pfam PF03951 |
| Family d.15.9.1: Glutamine synthetase, N-terminal domain [54369] (1 protein) |
| Protein Glutamine synthetase, N-terminal domain [54370] (2 species) |
| Domain d1htqt1: 1htq T:1-100 [71073] Other proteins in same PDB: d1htqa2, d1htqb2, d1htqc2, d1htqd2, d1htqe2, d1htqf2, d1htqg2, d1htqh2, d1htqi2, d1htqj2, d1htqk2, d1htql2, d1htqm2, d1htqn2, d1htqo2, d1htqp2, d1htqq2, d1htqr2, d1htqs2, d1htqt2, d1htqu2, d1htqv2, d1htqw2, d1htqx2 complexed with amp, cit, mn |
PDB Entry: 1htq (more details)
SCOPe Domain Sequences for d1htqt1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1htqt1 d.15.9.1 (T:1-100) Glutamine synthetase, N-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]}
tpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgfqsi
hesdmlllpdpetaridpfraaktlninffvhdpftlepy
Timeline for d1htqt1:
View in 3DDomains from other chains: (mouse over for more information) d1htqa1, d1htqa2, d1htqb1, d1htqb2, d1htqc1, d1htqc2, d1htqd1, d1htqd2, d1htqe1, d1htqe2, d1htqf1, d1htqf2, d1htqg1, d1htqg2, d1htqh1, d1htqh2, d1htqi1, d1htqi2, d1htqj1, d1htqj2, d1htqk1, d1htqk2, d1htql1, d1htql2, d1htqm1, d1htqm2, d1htqn1, d1htqn2, d1htqo1, d1htqo2, d1htqp1, d1htqp2, d1htqq1, d1htqq2, d1htqr1, d1htqr2, d1htqs1, d1htqs2, d1htqu1, d1htqu2, d1htqv1, d1htqv2, d1htqw1, d1htqw2, d1htqx1, d1htqx2 |