Lineage for d1htqr2 (1htq R:101-468)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 196400Fold d.128: Glutamine synthase/guanidino kinase catalytic domain [55930] (1 superfamily)
  4. 196401Superfamily d.128.1: Glutamine synthase/guanidino kinase catalytic domain [55931] (2 families) (S)
  5. 196402Family d.128.1.1: Glutamine synthetase, C-terminal domain [55932] (1 protein)
  6. 196403Protein Glutamine synthetase, C-terminal domain [55933] (2 species)
  7. 196404Species Mycobacterium tuberculosis [TaxId:1773] [75542] (2 PDB entries)
  8. 196422Domain d1htqr2: 1htq R:101-468 [71070]
    Other proteins in same PDB: d1htqa1, d1htqb1, d1htqc1, d1htqd1, d1htqe1, d1htqf1, d1htqg1, d1htqh1, d1htqi1, d1htqj1, d1htqk1, d1htql1, d1htqm1, d1htqn1, d1htqo1, d1htqp1, d1htqq1, d1htqr1, d1htqs1, d1htqt1, d1htqu1, d1htqv1, d1htqw1, d1htqx1

Details for d1htqr2

PDB Entry: 1htq (more details), 2.4 Å

PDB Description: multicopy crystallographic structure of a relaxed glutamine synthetase from mycobacterium tuberculosis

SCOP Domain Sequences for d1htqr2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1htqr2 d.128.1.1 (R:101-468) Glutamine synthetase, C-terminal domain {Mycobacterium tuberculosis}
srdprniarkaenylistgiadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwnt
gaateadgspnrgykvrhkggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsgg
qaeinyqfnsllhaaddmqlykyiikntawqngktvtfmpkplfgdngsgmhchqslwkd
gaplmydetgyaglsdtarhyiggllhhapsllaftnptvnsykrlvpgyeapinlvysq
rnrsacvripitgsnpkakrlefrspdssgnpylafsamlmagldgiknkiepqapvdkd
lyelppeeaasipqtptqlsdvidrleadheylteggvftndlietwisfkreneiepvn
irphpyefalyydv

SCOP Domain Coordinates for d1htqr2:

Click to download the PDB-style file with coordinates for d1htqr2.
(The format of our PDB-style files is described here.)

Timeline for d1htqr2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1htqr1
View in 3D
Domains from other chains:
(mouse over for more information)
d1htqa1, d1htqa2, d1htqb1, d1htqb2, d1htqc1, d1htqc2, d1htqd1, d1htqd2, d1htqe1, d1htqe2, d1htqf1, d1htqf2, d1htqg1, d1htqg2, d1htqh1, d1htqh2, d1htqi1, d1htqi2, d1htqj1, d1htqj2, d1htqk1, d1htqk2, d1htql1, d1htql2, d1htqm1, d1htqm2, d1htqn1, d1htqn2, d1htqo1, d1htqo2, d1htqp1, d1htqp2, d1htqq1, d1htqq2, d1htqs1, d1htqs2, d1htqt1, d1htqt2, d1htqu1, d1htqu2, d1htqv1, d1htqv2, d1htqw1, d1htqw2, d1htqx1, d1htqx2