Lineage for d1htqr1 (1htq R:1-100)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 325381Fold d.15: beta-Grasp (ubiquitin-like) [54235] (11 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 325972Superfamily d.15.9: Glutamine synthetase, N-terminal domain [54368] (1 family) (S)
  5. 325973Family d.15.9.1: Glutamine synthetase, N-terminal domain [54369] (1 protein)
  6. 325974Protein Glutamine synthetase, N-terminal domain [54370] (2 species)
  7. 325975Species Mycobacterium tuberculosis [TaxId:1773] [75372] (2 PDB entries)
  8. 325993Domain d1htqr1: 1htq R:1-100 [71069]
    Other proteins in same PDB: d1htqa2, d1htqb2, d1htqc2, d1htqd2, d1htqe2, d1htqf2, d1htqg2, d1htqh2, d1htqi2, d1htqj2, d1htqk2, d1htql2, d1htqm2, d1htqn2, d1htqo2, d1htqp2, d1htqq2, d1htqr2, d1htqs2, d1htqt2, d1htqu2, d1htqv2, d1htqw2, d1htqx2

Details for d1htqr1

PDB Entry: 1htq (more details), 2.4 Å

PDB Description: multicopy crystallographic structure of a relaxed glutamine synthetase from mycobacterium tuberculosis

SCOP Domain Sequences for d1htqr1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1htqr1 d.15.9.1 (R:1-100) Glutamine synthetase, N-terminal domain {Mycobacterium tuberculosis}
tpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgfqsi
hesdmlllpdpetaridpfraaktlninffvhdpftlepy

SCOP Domain Coordinates for d1htqr1:

Click to download the PDB-style file with coordinates for d1htqr1.
(The format of our PDB-style files is described here.)

Timeline for d1htqr1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1htqr2
View in 3D
Domains from other chains:
(mouse over for more information)
d1htqa1, d1htqa2, d1htqb1, d1htqb2, d1htqc1, d1htqc2, d1htqd1, d1htqd2, d1htqe1, d1htqe2, d1htqf1, d1htqf2, d1htqg1, d1htqg2, d1htqh1, d1htqh2, d1htqi1, d1htqi2, d1htqj1, d1htqj2, d1htqk1, d1htqk2, d1htql1, d1htql2, d1htqm1, d1htqm2, d1htqn1, d1htqn2, d1htqo1, d1htqo2, d1htqp1, d1htqp2, d1htqq1, d1htqq2, d1htqs1, d1htqs2, d1htqt1, d1htqt2, d1htqu1, d1htqu2, d1htqv1, d1htqv2, d1htqw1, d1htqw2, d1htqx1, d1htqx2