![]() | Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
![]() | Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily) duplication: common core consists of two beta-alpha-beta2-alpha repeats |
![]() | Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (6 families) ![]() |
![]() | Domain d1htqq2: 1htq Q:101-468 [71068] Other proteins in same PDB: d1htqa1, d1htqb1, d1htqc1, d1htqd1, d1htqe1, d1htqf1, d1htqg1, d1htqh1, d1htqi1, d1htqj1, d1htqk1, d1htql1, d1htqm1, d1htqn1, d1htqo1, d1htqp1, d1htqq1, d1htqr1, d1htqs1, d1htqt1, d1htqu1, d1htqv1, d1htqw1, d1htqx1 complexed with amp, cit, mn |
PDB Entry: 1htq (more details), 2.4 Å
SCOPe Domain Sequences for d1htqq2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1htqq2 d.128.1.1 (Q:101-468) Glutamine synthetase, C-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} srdprniarkaenylistgiadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwnt gaateadgspnrgykvrhkggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsgg qaeinyqfnsllhaaddmqlykyiikntawqngktvtfmpkplfgdngsgmhchqslwkd gaplmydetgyaglsdtarhyiggllhhapsllaftnptvnsykrlvpgyeapinlvysq rnrsacvripitgsnpkakrlefrspdssgnpylafsamlmagldgiknkiepqapvdkd lyelppeeaasipqtptqlsdvidrleadheylteggvftndlietwisfkreneiepvn irphpyefalyydv
Timeline for d1htqq2:
![]() Domains from other chains: (mouse over for more information) d1htqa1, d1htqa2, d1htqb1, d1htqb2, d1htqc1, d1htqc2, d1htqd1, d1htqd2, d1htqe1, d1htqe2, d1htqf1, d1htqf2, d1htqg1, d1htqg2, d1htqh1, d1htqh2, d1htqi1, d1htqi2, d1htqj1, d1htqj2, d1htqk1, d1htqk2, d1htql1, d1htql2, d1htqm1, d1htqm2, d1htqn1, d1htqn2, d1htqo1, d1htqo2, d1htqp1, d1htqp2, d1htqr1, d1htqr2, d1htqs1, d1htqs2, d1htqt1, d1htqt2, d1htqu1, d1htqu2, d1htqv1, d1htqv2, d1htqw1, d1htqw2, d1htqx1, d1htqx2 |