Lineage for d1htqp2 (1htq P:101-468)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1040112Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily)
    duplication: common core consists of two beta-alpha-beta2-alpha repeats
  4. 1040113Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (5 families) (S)
  5. 1040114Family d.128.1.1: Glutamine synthetase catalytic domain [55932] (1 protein)
  6. 1040115Protein Glutamine synthetase, C-terminal domain [55933] (2 species)
  7. 1040116Species Mycobacterium tuberculosis [TaxId:1773] [75542] (3 PDB entries)
  8. 1040138Domain d1htqp2: 1htq P:101-468 [71066]
    Other proteins in same PDB: d1htqa1, d1htqb1, d1htqc1, d1htqd1, d1htqe1, d1htqf1, d1htqg1, d1htqh1, d1htqi1, d1htqj1, d1htqk1, d1htql1, d1htqm1, d1htqn1, d1htqo1, d1htqp1, d1htqq1, d1htqr1, d1htqs1, d1htqt1, d1htqu1, d1htqv1, d1htqw1, d1htqx1
    complexed with amp, cit, mn

Details for d1htqp2

PDB Entry: 1htq (more details), 2.4 Å

PDB Description: multicopy crystallographic structure of a relaxed glutamine synthetase from mycobacterium tuberculosis
PDB Compounds: (P:) glutamine synthetase

SCOPe Domain Sequences for d1htqp2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1htqp2 d.128.1.1 (P:101-468) Glutamine synthetase, C-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]}
srdprniarkaenylistgiadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwnt
gaateadgspnrgykvrhkggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsgg
qaeinyqfnsllhaaddmqlykyiikntawqngktvtfmpkplfgdngsgmhchqslwkd
gaplmydetgyaglsdtarhyiggllhhapsllaftnptvnsykrlvpgyeapinlvysq
rnrsacvripitgsnpkakrlefrspdssgnpylafsamlmagldgiknkiepqapvdkd
lyelppeeaasipqtptqlsdvidrleadheylteggvftndlietwisfkreneiepvn
irphpyefalyydv

SCOPe Domain Coordinates for d1htqp2:

Click to download the PDB-style file with coordinates for d1htqp2.
(The format of our PDB-style files is described here.)

Timeline for d1htqp2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1htqp1
View in 3D
Domains from other chains:
(mouse over for more information)
d1htqa1, d1htqa2, d1htqb1, d1htqb2, d1htqc1, d1htqc2, d1htqd1, d1htqd2, d1htqe1, d1htqe2, d1htqf1, d1htqf2, d1htqg1, d1htqg2, d1htqh1, d1htqh2, d1htqi1, d1htqi2, d1htqj1, d1htqj2, d1htqk1, d1htqk2, d1htql1, d1htql2, d1htqm1, d1htqm2, d1htqn1, d1htqn2, d1htqo1, d1htqo2, d1htqq1, d1htqq2, d1htqr1, d1htqr2, d1htqs1, d1htqs2, d1htqt1, d1htqt2, d1htqu1, d1htqu2, d1htqv1, d1htqv2, d1htqw1, d1htqw2, d1htqx1, d1htqx2