| Class d: Alpha and beta proteins (a+b) [53931] (212 folds) |
| Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies) |
Superfamily d.15.9: Glutamine synthetase, N-terminal domain [54368] (1 family) ![]() |
| Family d.15.9.1: Glutamine synthetase, N-terminal domain [54369] (1 protein) |
| Protein Glutamine synthetase, N-terminal domain [54370] (2 species) |
| Species Mycobacterium tuberculosis [TaxId:1773] [75372] (2 PDB entries) |
| Domain d1htqp1: 1htq P:1-100 [71065] Other proteins in same PDB: d1htqa2, d1htqb2, d1htqc2, d1htqd2, d1htqe2, d1htqf2, d1htqg2, d1htqh2, d1htqi2, d1htqj2, d1htqk2, d1htql2, d1htqm2, d1htqn2, d1htqo2, d1htqp2, d1htqq2, d1htqr2, d1htqs2, d1htqt2, d1htqu2, d1htqv2, d1htqw2, d1htqx2 |
PDB Entry: 1htq (more details), 2.4 Å
SCOP Domain Sequences for d1htqp1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1htqp1 d.15.9.1 (P:1-100) Glutamine synthetase, N-terminal domain {Mycobacterium tuberculosis}
tpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgfqsi
hesdmlllpdpetaridpfraaktlninffvhdpftlepy
Timeline for d1htqp1:
View in 3DDomains from other chains: (mouse over for more information) d1htqa1, d1htqa2, d1htqb1, d1htqb2, d1htqc1, d1htqc2, d1htqd1, d1htqd2, d1htqe1, d1htqe2, d1htqf1, d1htqf2, d1htqg1, d1htqg2, d1htqh1, d1htqh2, d1htqi1, d1htqi2, d1htqj1, d1htqj2, d1htqk1, d1htqk2, d1htql1, d1htql2, d1htqm1, d1htqm2, d1htqn1, d1htqn2, d1htqo1, d1htqo2, d1htqq1, d1htqq2, d1htqr1, d1htqr2, d1htqs1, d1htqs2, d1htqt1, d1htqt2, d1htqu1, d1htqu2, d1htqv1, d1htqv2, d1htqw1, d1htqw2, d1htqx1, d1htqx2 |