SCOP 1.75: Domain d1htqo1: 1htq O:1-100

Lineage for d1htqo1 (1htq O:1-100)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.9: Glutamine synthetase, N-terminal domain [54368] (1 family)

5. Family d.15.9.1: Glutamine synthetase, N-terminal domain [54369] (1 protein)

6. Protein Glutamine synthetase, N-terminal domain [54370] (2 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [75372] (3 PDB entries)

8. Domain d1htqo1: 1htq O:1-100 [71063]
   Other proteins in same PDB: d1htqa2, d1htqb2, d1htqc2, d1htqd2, d1htqe2, d1htqf2, d1htqg2, d1htqh2, d1htqi2, d1htqj2, d1htqk2, d1htql2, d1htqm2, d1htqn2, d1htqo2, d1htqp2, d1htqq2, d1htqr2, d1htqs2, d1htqt2, d1htqu2, d1htqv2, d1htqw2, d1htqx2

Details for d1htqo1

PDB Entry: 1htq, 2.4 Å

PDB Description: multicopy crystallographic structure of a relaxed glutamine synthetase from mycobacterium tuberculosis

PDB Compounds: (O:) glutamine synthetase

SCOP Domain Sequences for d1htqo1:

Sequence; same for both SEQRES and ATOM records:

>d1htqo1 d.15.9.1 (O:1-100) Glutamine synthetase, N-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]}
tpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgfqsi
hesdmlllpdpetaridpfraaktlninffvhdpftlepy

Timeline for d1htqo1:

• d1htqo1 first appeared in SCOP 1.61
  
• d1htqo1 appears in SCOP 1.73
  
• d1htqo1 appears in SCOPe 2.01
  
• d1htqo1 appears in the current release, SCOPe 2.08