Lineage for d1htqk1 (1htq K:1-100)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538334Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2541920Superfamily d.15.9: Glutamine synthetase, N-terminal domain [54368] (2 families) (S)
    automatically mapped to Pfam PF03951
  5. 2541921Family d.15.9.1: Glutamine synthetase, N-terminal domain [54369] (1 protein)
  6. 2541922Protein Glutamine synthetase, N-terminal domain [54370] (2 species)
  7. Species Mycobacterium tuberculosis [TaxId:1773] [75372] (2 PDB entries)
  8. 2541958Domain d1htqk1: 1htq K:1-100 [71055]
    Other proteins in same PDB: d1htqa2, d1htqb2, d1htqc2, d1htqd2, d1htqe2, d1htqf2, d1htqg2, d1htqh2, d1htqi2, d1htqj2, d1htqk2, d1htql2, d1htqm2, d1htqn2, d1htqo2, d1htqp2, d1htqq2, d1htqr2, d1htqs2, d1htqt2, d1htqu2, d1htqv2, d1htqw2, d1htqx2
    complexed with amp, cit, mn

Details for d1htqk1

PDB Entry: 1htq (more details)

PDB Description: multicopy crystallographic structure of a relaxed glutamine synthetase from mycobacterium tuberculosis
PDB Compounds: (K:) glutamine synthetase

SCOPe Domain Sequences for d1htqk1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1htqk1 d.15.9.1 (K:1-100) Glutamine synthetase, N-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]}
tpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgfqsi
hesdmlllpdpetaridpfraaktlninffvhdpftlepy

SCOPe Domain Coordinates for d1htqk1:

Click to download the PDB-style file with coordinates for d1htqk1.
(The format of our PDB-style files is described here.)

Timeline for d1htqk1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1htqk2
View in 3D
Domains from other chains:
(mouse over for more information)
d1htqa1, d1htqa2, d1htqb1, d1htqb2, d1htqc1, d1htqc2, d1htqd1, d1htqd2, d1htqe1, d1htqe2, d1htqf1, d1htqf2, d1htqg1, d1htqg2, d1htqh1, d1htqh2, d1htqi1, d1htqi2, d1htqj1, d1htqj2, d1htql1, d1htql2, d1htqm1, d1htqm2, d1htqn1, d1htqn2, d1htqo1, d1htqo2, d1htqp1, d1htqp2, d1htqq1, d1htqq2, d1htqr1, d1htqr2, d1htqs1, d1htqs2, d1htqt1, d1htqt2, d1htqu1, d1htqu2, d1htqv1, d1htqv2, d1htqw1, d1htqw2, d1htqx1, d1htqx2