Lineage for d1htqi1 (1htq I:1-100)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 189214Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies)
  4. 189739Superfamily d.15.9: Glutamine synthetase, N-terminal domain [54368] (1 family) (S)
  5. 189740Family d.15.9.1: Glutamine synthetase, N-terminal domain [54369] (1 protein)
  6. 189741Protein Glutamine synthetase, N-terminal domain [54370] (2 species)
  7. 189742Species Mycobacterium tuberculosis [TaxId:1773] [75372] (2 PDB entries)
  8. 189751Domain d1htqi1: 1htq I:1-100 [71051]
    Other proteins in same PDB: d1htqa2, d1htqb2, d1htqc2, d1htqd2, d1htqe2, d1htqf2, d1htqg2, d1htqh2, d1htqi2, d1htqj2, d1htqk2, d1htql2, d1htqm2, d1htqn2, d1htqo2, d1htqp2, d1htqq2, d1htqr2, d1htqs2, d1htqt2, d1htqu2, d1htqv2, d1htqw2, d1htqx2

Details for d1htqi1

PDB Entry: 1htq (more details), 2.4 Å

PDB Description: multicopy crystallographic structure of a relaxed glutamine synthetase from mycobacterium tuberculosis

SCOP Domain Sequences for d1htqi1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1htqi1 d.15.9.1 (I:1-100) Glutamine synthetase, N-terminal domain {Mycobacterium tuberculosis}
tpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgfqsi
hesdmlllpdpetaridpfraaktlninffvhdpftlepy

SCOP Domain Coordinates for d1htqi1:

Click to download the PDB-style file with coordinates for d1htqi1.
(The format of our PDB-style files is described here.)

Timeline for d1htqi1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1htqi2
View in 3D
Domains from other chains:
(mouse over for more information)
d1htqa1, d1htqa2, d1htqb1, d1htqb2, d1htqc1, d1htqc2, d1htqd1, d1htqd2, d1htqe1, d1htqe2, d1htqf1, d1htqf2, d1htqg1, d1htqg2, d1htqh1, d1htqh2, d1htqj1, d1htqj2, d1htqk1, d1htqk2, d1htql1, d1htql2, d1htqm1, d1htqm2, d1htqn1, d1htqn2, d1htqo1, d1htqo2, d1htqp1, d1htqp2, d1htqq1, d1htqq2, d1htqr1, d1htqr2, d1htqs1, d1htqs2, d1htqt1, d1htqt2, d1htqu1, d1htqu2, d1htqv1, d1htqv2, d1htqw1, d1htqw2, d1htqx1, d1htqx2