Lineage for d1htqh2 (1htq H:101-468)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2974757Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily)
    duplication: common core consists of two beta-alpha-beta2-alpha repeats
  4. 2974758Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (6 families) (S)
  5. 2974759Family d.128.1.1: Glutamine synthetase catalytic domain [55932] (2 proteins)
  6. 2974760Protein Glutamine synthetase, C-terminal domain [55933] (2 species)
  7. Species Mycobacterium tuberculosis [TaxId:1773] [75542] (2 PDB entries)
  8. 2974793Domain d1htqh2: 1htq H:101-468 [71050]
    Other proteins in same PDB: d1htqa1, d1htqb1, d1htqc1, d1htqd1, d1htqe1, d1htqf1, d1htqg1, d1htqh1, d1htqi1, d1htqj1, d1htqk1, d1htql1, d1htqm1, d1htqn1, d1htqo1, d1htqp1, d1htqq1, d1htqr1, d1htqs1, d1htqt1, d1htqu1, d1htqv1, d1htqw1, d1htqx1
    complexed with amp, cit, mn

Details for d1htqh2

PDB Entry: 1htq (more details)

PDB Description: multicopy crystallographic structure of a relaxed glutamine synthetase from mycobacterium tuberculosis
PDB Compounds: (H:) glutamine synthetase

SCOPe Domain Sequences for d1htqh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1htqh2 d.128.1.1 (H:101-468) Glutamine synthetase, C-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]}
srdprniarkaenylistgiadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwnt
gaateadgspnrgykvrhkggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsgg
qaeinyqfnsllhaaddmqlykyiikntawqngktvtfmpkplfgdngsgmhchqslwkd
gaplmydetgyaglsdtarhyiggllhhapsllaftnptvnsykrlvpgyeapinlvysq
rnrsacvripitgsnpkakrlefrspdssgnpylafsamlmagldgiknkiepqapvdkd
lyelppeeaasipqtptqlsdvidrleadheylteggvftndlietwisfkreneiepvn
irphpyefalyydv

SCOPe Domain Coordinates for d1htqh2:

Click to download the PDB-style file with coordinates for d1htqh2.
(The format of our PDB-style files is described here.)

Timeline for d1htqh2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1htqh1
View in 3D
Domains from other chains:
(mouse over for more information)
d1htqa1, d1htqa2, d1htqb1, d1htqb2, d1htqc1, d1htqc2, d1htqd1, d1htqd2, d1htqe1, d1htqe2, d1htqf1, d1htqf2, d1htqg1, d1htqg2, d1htqi1, d1htqi2, d1htqj1, d1htqj2, d1htqk1, d1htqk2, d1htql1, d1htql2, d1htqm1, d1htqm2, d1htqn1, d1htqn2, d1htqo1, d1htqo2, d1htqp1, d1htqp2, d1htqq1, d1htqq2, d1htqr1, d1htqr2, d1htqs1, d1htqs2, d1htqt1, d1htqt2, d1htqu1, d1htqu2, d1htqv1, d1htqv2, d1htqw1, d1htqw2, d1htqx1, d1htqx2