SCOPe 2.08: Domain d1htqf2: 1htq F:101-468

Lineage for d1htqf2 (1htq F:101-468)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily)
   duplication: common core consists of two beta-alpha-beta2-alpha repeats

4. Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (6 families)

5. Family d.128.1.1: Glutamine synthetase catalytic domain [55932] (2 proteins)

6. Protein Glutamine synthetase, C-terminal domain [55933] (2 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [75542] (2 PDB entries)

8. Domain d1htqf2: 1htq F:101-468 [71046]
   Other proteins in same PDB: d1htqa1, d1htqb1, d1htqc1, d1htqd1, d1htqe1, d1htqf1, d1htqg1, d1htqh1, d1htqi1, d1htqj1, d1htqk1, d1htql1, d1htqm1, d1htqn1, d1htqo1, d1htqp1, d1htqq1, d1htqr1, d1htqs1, d1htqt1, d1htqu1, d1htqv1, d1htqw1, d1htqx1
   complexed with amp, cit, mn

Details for d1htqf2

PDB Entry: 1htq

PDB Description: multicopy crystallographic structure of a relaxed glutamine synthetase from mycobacterium tuberculosis

PDB Compounds: (F:) glutamine synthetase

SCOPe Domain Sequences for d1htqf2:

Sequence; same for both SEQRES and ATOM records:

>d1htqf2 d.128.1.1 (F:101-468) Glutamine synthetase, C-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]}
srdprniarkaenylistgiadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwnt
gaateadgspnrgykvrhkggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsgg
qaeinyqfnsllhaaddmqlykyiikntawqngktvtfmpkplfgdngsgmhchqslwkd
gaplmydetgyaglsdtarhyiggllhhapsllaftnptvnsykrlvpgyeapinlvysq
rnrsacvripitgsnpkakrlefrspdssgnpylafsamlmagldgiknkiepqapvdkd
lyelppeeaasipqtptqlsdvidrleadheylteggvftndlietwisfkreneiepvn
irphpyefalyydv

Timeline for d1htqf2:

• d1htqf2 first appeared in SCOP 1.61
  
• d1htqf2 appears in SCOPe 2.07