Lineage for d1htot2 (1hto T:101-468)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 196400Fold d.128: Glutamine synthase/guanidino kinase catalytic domain [55930] (1 superfamily)
  4. 196401Superfamily d.128.1: Glutamine synthase/guanidino kinase catalytic domain [55931] (2 families) (S)
  5. 196402Family d.128.1.1: Glutamine synthetase, C-terminal domain [55932] (1 protein)
  6. 196403Protein Glutamine synthetase, C-terminal domain [55933] (2 species)
  7. 196404Species Mycobacterium tuberculosis [TaxId:1773] [75542] (2 PDB entries)
  8. 196448Domain d1htot2: 1hto T:101-468 [71026]
    Other proteins in same PDB: d1htoa1, d1htob1, d1htoc1, d1htod1, d1htoe1, d1htof1, d1htog1, d1htoh1, d1htoi1, d1htoj1, d1htok1, d1htol1, d1htom1, d1hton1, d1htoo1, d1htop1, d1htoq1, d1htor1, d1htos1, d1htot1, d1htou1, d1htov1, d1htow1, d1htox1

Details for d1htot2

PDB Entry: 1hto (more details), 2.4 Å

PDB Description: crystallographic structure of a relaxed glutamine synthetase from mycobacterium tuberculosis

SCOP Domain Sequences for d1htot2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1htot2 d.128.1.1 (T:101-468) Glutamine synthetase, C-terminal domain {Mycobacterium tuberculosis}
srdprniarkaenylistgiadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwnt
gaateadgspnrgykvrhkggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsgg
qaeinyqfnsllhaaddmqlykyiikntawqngktvtfmpkplfgdngsgmhchqslwkd
gaplmydetgyaglsdtarhyiggllhhapsllaftnptvnsykrlvpgyeapinlvysq
rnrsacvripitgsnpkakrlefrspdssgnpylafsamlmagldgiknkiepqapvdkd
lyelppeeaasipqtptqlsdvidrleadheylteggvftndlietwisfkreneiepvn
irphpyefalyydv

SCOP Domain Coordinates for d1htot2:

Click to download the PDB-style file with coordinates for d1htot2.
(The format of our PDB-style files is described here.)

Timeline for d1htot2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1htot1
View in 3D
Domains from other chains:
(mouse over for more information)
d1htoa1, d1htoa2, d1htob1, d1htob2, d1htoc1, d1htoc2, d1htod1, d1htod2, d1htoe1, d1htoe2, d1htof1, d1htof2, d1htog1, d1htog2, d1htoh1, d1htoh2, d1htoi1, d1htoi2, d1htoj1, d1htoj2, d1htok1, d1htok2, d1htol1, d1htol2, d1htom1, d1htom2, d1hton1, d1hton2, d1htoo1, d1htoo2, d1htop1, d1htop2, d1htoq1, d1htoq2, d1htor1, d1htor2, d1htos1, d1htos2, d1htou1, d1htou2, d1htov1, d1htov2, d1htow1, d1htow2, d1htox1, d1htox2