![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily) duplication: common core consists of two beta-alpha-beta2-alpha repeats |
![]() | Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (5 families) ![]() |
![]() | Family d.128.1.1: Glutamine synthetase catalytic domain [55932] (1 protein) |
![]() | Protein Glutamine synthetase, C-terminal domain [55933] (2 species) |
![]() | Species Mycobacterium tuberculosis [TaxId:1773] [75542] (3 PDB entries) |
![]() | Domain d1hton2: 1hto N:101-468 [71014] Other proteins in same PDB: d1htoa1, d1htob1, d1htoc1, d1htod1, d1htoe1, d1htof1, d1htog1, d1htoh1, d1htoi1, d1htoj1, d1htok1, d1htol1, d1htom1, d1hton1, d1htoo1, d1htop1, d1htoq1, d1htor1, d1htos1, d1htot1, d1htou1, d1htov1, d1htow1, d1htox1 |
PDB Entry: 1hto (more details), 2.4 Å
SCOP Domain Sequences for d1hton2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hton2 d.128.1.1 (N:101-468) Glutamine synthetase, C-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} srdprniarkaenylistgiadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwnt gaateadgspnrgykvrhkggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsgg qaeinyqfnsllhaaddmqlykyiikntawqngktvtfmpkplfgdngsgmhchqslwkd gaplmydetgyaglsdtarhyiggllhhapsllaftnptvnsykrlvpgyeapinlvysq rnrsacvripitgsnpkakrlefrspdssgnpylafsamlmagldgiknkiepqapvdkd lyelppeeaasipqtptqlsdvidrleadheylteggvftndlietwisfkreneiepvn irphpyefalyydv
Timeline for d1hton2:
![]() Domains from other chains: (mouse over for more information) d1htoa1, d1htoa2, d1htob1, d1htob2, d1htoc1, d1htoc2, d1htod1, d1htod2, d1htoe1, d1htoe2, d1htof1, d1htof2, d1htog1, d1htog2, d1htoh1, d1htoh2, d1htoi1, d1htoi2, d1htoj1, d1htoj2, d1htok1, d1htok2, d1htol1, d1htol2, d1htom1, d1htom2, d1htoo1, d1htoo2, d1htop1, d1htop2, d1htoq1, d1htoq2, d1htor1, d1htor2, d1htos1, d1htos2, d1htot1, d1htot2, d1htou1, d1htou2, d1htov1, d1htov2, d1htow1, d1htow2, d1htox1, d1htox2 |