SCOPe 2.02: Domain d1htog1: 1hto G:1-100

Lineage for d1htog1 (1hto G:1-100)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.9: Glutamine synthetase, N-terminal domain [54368] (1 family)

5. Family d.15.9.1: Glutamine synthetase, N-terminal domain [54369] (1 protein)

6. Protein Glutamine synthetase, N-terminal domain [54370] (2 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [75372] (3 PDB entries)

8. Domain d1htog1: 1hto G:1-100 [70999]
   Other proteins in same PDB: d1htoa2, d1htob2, d1htoc2, d1htod2, d1htoe2, d1htof2, d1htog2, d1htoh2, d1htoi2, d1htoj2, d1htok2, d1htol2, d1htom2, d1hton2, d1htoo2, d1htop2, d1htoq2, d1htor2, d1htos2, d1htot2, d1htou2, d1htov2, d1htow2, d1htox2
   complexed with amp, cit, mn

Details for d1htog1

PDB Entry: 1hto, 2.4 Å

PDB Description: crystallographic structure of a relaxed glutamine synthetase from mycobacterium tuberculosis

PDB Compounds: (G:) glutamine synthetase

SCOPe Domain Sequences for d1htog1:

Sequence; same for both SEQRES and ATOM records:

>d1htog1 d.15.9.1 (G:1-100) Glutamine synthetase, N-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]}
tpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgfqsi
hesdmlllpdpetaridpfraaktlninffvhdpftlepy

Timeline for d1htog1:

• d1htog1 first appeared in SCOP 1.61
  
• d1htog1 appears in SCOPe 2.01
  
• d1htog1 appears in SCOPe 2.03
  
• d1htog1 appears in the current release, SCOPe 2.08