Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.9: Glutamine synthetase, N-terminal domain [54368] (1 family) |
Family d.15.9.1: Glutamine synthetase, N-terminal domain [54369] (1 protein) |
Protein Glutamine synthetase, N-terminal domain [54370] (2 species) |
Species Mycobacterium tuberculosis [TaxId:1773] [75372] (3 PDB entries) |
Domain d1htog1: 1hto G:1-100 [70999] Other proteins in same PDB: d1htoa2, d1htob2, d1htoc2, d1htod2, d1htoe2, d1htof2, d1htog2, d1htoh2, d1htoi2, d1htoj2, d1htok2, d1htol2, d1htom2, d1hton2, d1htoo2, d1htop2, d1htoq2, d1htor2, d1htos2, d1htot2, d1htou2, d1htov2, d1htow2, d1htox2 complexed with amp, cit, mn |
PDB Entry: 1hto (more details), 2.4 Å
SCOPe Domain Sequences for d1htog1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1htog1 d.15.9.1 (G:1-100) Glutamine synthetase, N-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} tpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgfqsi hesdmlllpdpetaridpfraaktlninffvhdpftlepy
Timeline for d1htog1:
View in 3D Domains from other chains: (mouse over for more information) d1htoa1, d1htoa2, d1htob1, d1htob2, d1htoc1, d1htoc2, d1htod1, d1htod2, d1htoe1, d1htoe2, d1htof1, d1htof2, d1htoh1, d1htoh2, d1htoi1, d1htoi2, d1htoj1, d1htoj2, d1htok1, d1htok2, d1htol1, d1htol2, d1htom1, d1htom2, d1hton1, d1hton2, d1htoo1, d1htoo2, d1htop1, d1htop2, d1htoq1, d1htoq2, d1htor1, d1htor2, d1htos1, d1htos2, d1htot1, d1htot2, d1htou1, d1htou2, d1htov1, d1htov2, d1htow1, d1htow2, d1htox1, d1htox2 |