Lineage for d1htoe1 (1hto E:1-100)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 189214Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies)
  4. 189739Superfamily d.15.9: Glutamine synthetase, N-terminal domain [54368] (1 family) (S)
  5. 189740Family d.15.9.1: Glutamine synthetase, N-terminal domain [54369] (1 protein)
  6. 189741Protein Glutamine synthetase, N-terminal domain [54370] (2 species)
  7. 189742Species Mycobacterium tuberculosis [TaxId:1773] [75372] (2 PDB entries)
  8. 189771Domain d1htoe1: 1hto E:1-100 [70995]
    Other proteins in same PDB: d1htoa2, d1htob2, d1htoc2, d1htod2, d1htoe2, d1htof2, d1htog2, d1htoh2, d1htoi2, d1htoj2, d1htok2, d1htol2, d1htom2, d1hton2, d1htoo2, d1htop2, d1htoq2, d1htor2, d1htos2, d1htot2, d1htou2, d1htov2, d1htow2, d1htox2

Details for d1htoe1

PDB Entry: 1hto (more details), 2.4 Å

PDB Description: crystallographic structure of a relaxed glutamine synthetase from mycobacterium tuberculosis

SCOP Domain Sequences for d1htoe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1htoe1 d.15.9.1 (E:1-100) Glutamine synthetase, N-terminal domain {Mycobacterium tuberculosis}
tpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgfqsi
hesdmlllpdpetaridpfraaktlninffvhdpftlepy

SCOP Domain Coordinates for d1htoe1:

Click to download the PDB-style file with coordinates for d1htoe1.
(The format of our PDB-style files is described here.)

Timeline for d1htoe1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1htoe2
View in 3D
Domains from other chains:
(mouse over for more information)
d1htoa1, d1htoa2, d1htob1, d1htob2, d1htoc1, d1htoc2, d1htod1, d1htod2, d1htof1, d1htof2, d1htog1, d1htog2, d1htoh1, d1htoh2, d1htoi1, d1htoi2, d1htoj1, d1htoj2, d1htok1, d1htok2, d1htol1, d1htol2, d1htom1, d1htom2, d1hton1, d1hton2, d1htoo1, d1htoo2, d1htop1, d1htop2, d1htoq1, d1htoq2, d1htor1, d1htor2, d1htos1, d1htos2, d1htot1, d1htot2, d1htou1, d1htou2, d1htov1, d1htov2, d1htow1, d1htow2, d1htox1, d1htox2