SCOP 1.71: Domain d1hpub1: 1hpu B:363-550

Lineage for d1hpub1 (1hpu B:363-550)

Root: SCOP 1.71
Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
Fold d.114: 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain [55815] (1 superfamily)
core: alpha-beta(2)-alpha-beta(2)-alpha-beta; 3 layers; mixed sheet: order 31425
Superfamily d.114.1: 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain [55816] (1 family)
Family d.114.1.1: 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain [55817] (1 protein)
Protein 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain [55818] (1 species)
Species Escherichia coli [TaxId:562] [55819] (8 PDB entries)
Domain d1hpub1: 1hpu B:363-550 [70981]
Other proteins in same PDB: d1hpua2, d1hpub2, d1hpuc2, d1hpud2

Details for d1hpub1

PDB Entry: 1hpu (more details), 1.85 Å

PDB Description: 5'-nucleotidase (closed form), complex with ampcp

SCOP Domain Sequences for d1hpub1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hpub1 d.114.1.1 (B:363-550) 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain {Escherichia coli}
kigetngrlegdrdkvrfvqtnmgrlilaaqmdrtgadfavmsgggirdsieagdisykn
vlkvqpfgnvvvyadmtgkevidyltavaqmkpdsgaypqfanvsfvakdgklndlkikg
epvdpaktyrmatlnfnatggdgyprldnkpgyvntgfidaevlkayiqksspldvsvye
pkgevswq

SCOP Domain Coordinates for d1hpub1:

Click to download the PDB-style file with coordinates for d1hpub1.
(The format of our PDB-style files is described here.)

Timeline for d1hpub1: