Lineage for d1hpua1 (1hpu A:363-550)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2211920Fold d.114: 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain [55815] (1 superfamily)
    core: alpha-beta(2)-alpha-beta(2)-alpha-beta; 3 layers; mixed sheet: order 31425
  4. 2211921Superfamily d.114.1: 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain [55816] (2 families) (S)
  5. 2211922Family d.114.1.1: 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain [55817] (1 protein)
  6. 2211923Protein 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain [55818] (3 species)
  7. 2211924Species Escherichia coli [TaxId:562] [55819] (8 PDB entries)
    Uniprot P07024 26-550
  8. 2211927Domain d1hpua1: 1hpu A:363-550 [70979]
    Other proteins in same PDB: d1hpua2, d1hpub2, d1hpuc2, d1hpud2
    complexed with a12, mn

Details for d1hpua1

PDB Entry: 1hpu (more details), 1.85 Å

PDB Description: 5'-nucleotidase (closed form), complex with ampcp
PDB Compounds: (A:) 5'-nucleotidase

SCOPe Domain Sequences for d1hpua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hpua1 d.114.1.1 (A:363-550) 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain {Escherichia coli [TaxId: 562]}
kigetngrlegdrdkvrfvqtnmgrlilaaqmdrtgadfavmsgggirdsieagdisykn
vlkvqpfgnvvvyadmtgkevidyltavaqmkpdsgaypqfanvsfvakdgklndlkikg
epvdpaktyrmatlnfnatggdgyprldnkpgyvntgfidaevlkayiqksspldvsvye
pkgevswq

SCOPe Domain Coordinates for d1hpua1:

Click to download the PDB-style file with coordinates for d1hpua1.
(The format of our PDB-style files is described here.)

Timeline for d1hpua1: