Lineage for d1hp1a1 (1hp1 A:363-550)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2971955Fold d.114: 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain [55815] (1 superfamily)
    core: alpha-beta(2)-alpha-beta(2)-alpha-beta; 3 layers; mixed sheet: order 31425
  4. 2971956Superfamily d.114.1: 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain [55816] (2 families) (S)
  5. 2971957Family d.114.1.1: 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain [55817] (1 protein)
  6. 2971958Protein 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain [55818] (3 species)
  7. 2971959Species Escherichia coli [TaxId:562] [55819] (8 PDB entries)
    Uniprot P07024 26-550
  8. 2971960Domain d1hp1a1: 1hp1 A:363-550 [70976]
    Other proteins in same PDB: d1hp1a2
    complexed with atp, co3, so4, zn

Details for d1hp1a1

PDB Entry: 1hp1 (more details), 1.7 Å

PDB Description: 5'-nucleotidase (open form) complex with atp
PDB Compounds: (A:) 5'-nucleotidase

SCOPe Domain Sequences for d1hp1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hp1a1 d.114.1.1 (A:363-550) 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain {Escherichia coli [TaxId: 562]}
kigetngrlegdrdkvrfvqtnmgrlilaaqmdrtgadfavmsgggirdsieagdisykn
vlkvqpfgnvvvyadmtgkevidyltavaqmkpdsgaypqfanvsfvakdgklndlkikg
epvdpaktyrmatlnfnatggdgyprldnkpgyvntgfidaevlkayiqksspldvsvye
pkgevswq

SCOPe Domain Coordinates for d1hp1a1:

Click to download the PDB-style file with coordinates for d1hp1a1.
(The format of our PDB-style files is described here.)

Timeline for d1hp1a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hp1a2