Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily) 4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication |
Superfamily d.159.1: Metallo-dependent phosphatases [56300] (9 families) different families of this superfamily are groupped in a single Pfam family, Pfam 00149 |
Family d.159.1.2: 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain [56307] (1 protein) |
Protein 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain [56308] (1 species) |
Species Escherichia coli [TaxId:562] [56309] (8 PDB entries) |
Domain d1ho5b2: 1ho5 B:26-362 [70971] Other proteins in same PDB: d1ho5a1, d1ho5b1 complexed with adn, mn, po4 |
PDB Entry: 1ho5 (more details), 2.1 Å
SCOP Domain Sequences for d1ho5b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ho5b2 d.159.1.2 (B:26-362) 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain {Escherichia coli} yeqdktykitvlhtndhhghfwrneygeyglaaqktlvdgirkevaaeggsvlllsggdi ntgvpesdlqdaepdfrgmnlvgydamaignhefdnpltvlrqqekwakfpllsaniyqk stgerlfkpwalfkrqdlkiaviglttddtakignpeyftdiefrkpadeaklviqelqq tekpdiiiaathmghydngehgsnapgdvemaralpagslamivgghsqdpvcmaaenkk qvdyvpgtpckpdqqngiwivqahewgkyvgradfefrngemkmvnyqlipvnlkkkvtw edgkservlytpeiaenqqmisllspfqnkgkaqlev
Timeline for d1ho5b2: