Lineage for d1ho5a2 (1ho5 A:26-362)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2231921Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. 2231922Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) (S)
    different families of this superfamily are groupped in a single Pfam family, Pfam PF00149
  5. 2231975Family d.159.1.2: 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain [56307] (2 proteins)
  6. 2231976Protein 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain [56308] (3 species)
  7. 2231977Species Escherichia coli [TaxId:562] [56309] (8 PDB entries)
    Uniprot P07024 26-550
  8. 2231991Domain d1ho5a2: 1ho5 A:26-362 [70969]
    Other proteins in same PDB: d1ho5a1, d1ho5b1
    complexed with adn, mn, po4

Details for d1ho5a2

PDB Entry: 1ho5 (more details), 2.1 Å

PDB Description: 5'-nucleotidase (e. coli) in complex with adenosine and phosphate
PDB Compounds: (A:) 5'-nucleotidase

SCOPe Domain Sequences for d1ho5a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ho5a2 d.159.1.2 (A:26-362) 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain {Escherichia coli [TaxId: 562]}
yeqdktykitvlhtndhhghfwrneygeyglaaqktlvdgirkevaaeggsvlllsggdi
ntgvpesdlqdaepdfrgmnlvgydamaignhefdnpltvlrqqekwakfpllsaniyqk
stgerlfkpwalfkrqdlkiaviglttddtakignpeyftdiefrkpadeaklviqelqq
tekpdiiiaathmghydngehgsnapgdvemaralpagslamivgghsqdpvcmaaenkk
qvdyvpgtpckpdqqngiwivqahewgkyvgradfefrngemkmvnyqlipvnlkkkvtw
edgkservlytpeiaenqqmisllspfqnkgkaqlev

SCOPe Domain Coordinates for d1ho5a2:

Click to download the PDB-style file with coordinates for d1ho5a2.
(The format of our PDB-style files is described here.)

Timeline for d1ho5a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ho5a1