![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily) 4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication |
![]() | Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) ![]() different families of this superfamily are groupped in a single Pfam family, Pfam PF00149 |
![]() | Family d.159.1.2: 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain [56307] (2 proteins) |
![]() | Protein 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain [56308] (3 species) |
![]() | Species Escherichia coli [TaxId:562] [56309] (8 PDB entries) Uniprot P07024 26-550 |
![]() | Domain d1ho5a2: 1ho5 A:26-362 [70969] Other proteins in same PDB: d1ho5a1, d1ho5b1 complexed with adn, mn, po4 |
PDB Entry: 1ho5 (more details), 2.1 Å
SCOPe Domain Sequences for d1ho5a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ho5a2 d.159.1.2 (A:26-362) 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain {Escherichia coli [TaxId: 562]} yeqdktykitvlhtndhhghfwrneygeyglaaqktlvdgirkevaaeggsvlllsggdi ntgvpesdlqdaepdfrgmnlvgydamaignhefdnpltvlrqqekwakfpllsaniyqk stgerlfkpwalfkrqdlkiaviglttddtakignpeyftdiefrkpadeaklviqelqq tekpdiiiaathmghydngehgsnapgdvemaralpagslamivgghsqdpvcmaaenkk qvdyvpgtpckpdqqngiwivqahewgkyvgradfefrngemkmvnyqlipvnlkkkvtw edgkservlytpeiaenqqmisllspfqnkgkaqlev
Timeline for d1ho5a2: