Lineage for d1hcha_ (1hch A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2719957Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2719958Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2719959Family a.93.1.1: CCP-like [48114] (5 proteins)
  6. 2720260Protein Plant peroxidase [48125] (6 species)
  7. 2720263Species Horseradish (Armoracia rusticana) [TaxId:3704] [48126] (29 PDB entries)
  8. 2720265Domain d1hcha_: 1hch A: [70965]
    complexed with act, ca, hem, o

Details for d1hcha_

PDB Entry: 1hch (more details), 1.57 Å

PDB Description: structure of horseradish peroxidase c1a compound i
PDB Compounds: (A:) peroxidase c1a

SCOPe Domain Sequences for d1hcha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hcha_ a.93.1.1 (A:) Plant peroxidase {Horseradish (Armoracia rusticana) [TaxId: 3704]}
qltptfydnscpnvsnivrdtivnelrsdpriaasilrlhfhdcfvngcdasilldntts
frtekdafgnansargfpvidrmkaavesacprtvscadlltiaaqqsvtlaggpswrvp
lgrrdslqafldlananlpapfftlpqlkdsfrnvglnrssdlvalsgghtfgknqcrfi
mdrlynfsntglpdptlnttylqtlrglcplngnlsalvdfdlrtptifdnkyyvnleeq
kgliqsdqelfsspnatdtiplvrsfanstqtffnafveamdrmgnitpltgtqgqirln
crvvns

SCOPe Domain Coordinates for d1hcha_:

Click to download the PDB-style file with coordinates for d1hcha_.
(The format of our PDB-style files is described here.)

Timeline for d1hcha_: