Class a: All alpha proteins [46456] (285 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.7: Ribosomal protein L11, C-terminal domain [46906] (1 family) |
Family a.4.7.1: Ribosomal protein L11, C-terminal domain [46907] (1 protein) |
Protein Ribosomal protein L11, C-terminal domain [46908] (6 species) |
Species Bacillus stearothermophilus [TaxId:1422] [46909] (8 PDB entries) |
Domain d1hc8a_: 1hc8 A: [70963] protein/RNA complex; complexed with k, mg, os |
PDB Entry: 1hc8 (more details), 2.8 Å
SCOPe Domain Sequences for d1hc8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hc8a_ a.4.7.1 (A:) Ribosomal protein L11, C-terminal domain {Bacillus stearothermophilus [TaxId: 1422]} tfitktppaavllkkaagiesgsgepnrnkvatikrdkvreiaelkmpdlnaasieaamr miegtarsmgivve
Timeline for d1hc8a_: