SCOP 1.75: Domain d1hc8a_: 1hc8 A:

Lineage for d1hc8a_ (1hc8 A:)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.7: Ribosomal protein L11, C-terminal domain [46906] (1 family)

5. Family a.4.7.1: Ribosomal protein L11, C-terminal domain [46907] (1 protein)

6. Protein Ribosomal protein L11, C-terminal domain [46908] (6 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [46909] (8 PDB entries)

8. Domain d1hc8a_: 1hc8 A: [70963]

Details for d1hc8a_

PDB Entry: 1hc8, 2.8 Å

PDB Description: crystal structure of a conserved ribosomal protein-rna complex

PDB Compounds: (A:) ribosomal protein l11

SCOP Domain Sequences for d1hc8a_:

Sequence; same for both SEQRES and ATOM records:

>d1hc8a_ a.4.7.1 (A:) Ribosomal protein L11, C-terminal domain {Bacillus stearothermophilus [TaxId: 1422]}
tfitktppaavllkkaagiesgsgepnrnkvatikrdkvreiaelkmpdlnaasieaamr
miegtarsmgivve

Timeline for d1hc8a_:

• d1hc8a_ first appeared in SCOP 1.61
  
• d1hc8a_ appears in SCOP 1.73
  
• d1hc8a_ appears in SCOPe 2.01
  
• d1hc8a_ appears in the current release, SCOPe 2.08