Lineage for d1hb8a_ (1hb8 A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1725169Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies)
    core: 3 helices; bundle, closed, left-handed twist; up-and-down
  4. 1725170Superfamily a.11.1: Acyl-CoA binding protein [47027] (2 families) (S)
  5. 1725171Family a.11.1.1: Acyl-CoA binding protein [47028] (2 proteins)
    automatically mapped to Pfam PF00887
  6. 1725172Protein Acyl-CoA binding protein [47029] (2 species)
  7. 1725173Species Cow (Bos taurus) [TaxId:9913] [47030] (6 PDB entries)
    Uniprot P07107
  8. 1725175Domain d1hb8a_: 1hb8 A: [70960]
    complexed with so4

Details for d1hb8a_

PDB Entry: 1hb8 (more details), 2 Å

PDB Description: structure of bovine acyl-coa binding protein in tetragonal crystal form
PDB Compounds: (A:) acyl-coa binding protein

SCOPe Domain Sequences for d1hb8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hb8a_ a.11.1.1 (A:) Acyl-CoA binding protein {Cow (Bos taurus) [TaxId: 9913]}
sqaefdkaaeevkhlktkpadeemlfiyshykqatvgdinterpgmldfkgkakwdawne
lkgtskedamkayidkveelkkkygi

SCOPe Domain Coordinates for d1hb8a_:

Click to download the PDB-style file with coordinates for d1hb8a_.
(The format of our PDB-style files is described here.)

Timeline for d1hb8a_: