Lineage for d1ha7v_ (1ha7 V:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1715732Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1715733Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1718119Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
    oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
    binds a bilin chromophore
    automatically mapped to Pfam PF00502
  6. 1718215Protein Phycocyanin beta subunit [88940] (8 species)
  7. 1718225Species Spirulina platensis [TaxId:118562] [88952] (2 PDB entries)
  8. 1718236Domain d1ha7v_: 1ha7 V: [70956]
    Other proteins in same PDB: d1ha7a_, d1ha7c_, d1ha7e_, d1ha7g_, d1ha7i_, d1ha7k_, d1ha7m_, d1ha7o_, d1ha7q_, d1ha7s_, d1ha7u_, d1ha7w_
    complexed with cyc

Details for d1ha7v_

PDB Entry: 1ha7 (more details), 2.2 Å

PDB Description: structure of a light-harvesting phycobiliprotein, c-phycocyanin from spirulina platensis at 2.2a resolution
PDB Compounds: (V:) C-phycocyanin beta chain

SCOPe Domain Sequences for d1ha7v_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ha7v_ a.1.1.3 (V:) Phycocyanin beta subunit {Spirulina platensis [TaxId: 118562]}
mfdaftkvvsqadtrgemlstaqidalsqmvaesnkrldavnritsnastivsnaarslf
aeqpqliapggnaytsrrmaaclrdmeiilryvtyavfagdasvledrclnglretylal
gtpgssvavgvgkmkeaalaivndpagitpgdcsalaseiasyfdracaavs

SCOPe Domain Coordinates for d1ha7v_:

Click to download the PDB-style file with coordinates for d1ha7v_.
(The format of our PDB-style files is described here.)

Timeline for d1ha7v_: