Lineage for d1ha7g_ (1ha7 G:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1715732Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1715733Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1718119Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
    oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
    binds a bilin chromophore
    automatically mapped to Pfam PF00502
  6. 1718144Protein Phycocyanin alpha subunit [88933] (9 species)
  7. 1718161Species Spirulina platensis [TaxId:118562] [88939] (2 PDB entries)
  8. 1718165Domain d1ha7g_: 1ha7 G: [70941]
    Other proteins in same PDB: d1ha7b_, d1ha7d_, d1ha7f_, d1ha7h_, d1ha7j_, d1ha7l_, d1ha7n_, d1ha7p_, d1ha7r_, d1ha7t_, d1ha7v_, d1ha7x_
    complexed with cyc

Details for d1ha7g_

PDB Entry: 1ha7 (more details), 2.2 Å

PDB Description: structure of a light-harvesting phycobiliprotein, c-phycocyanin from spirulina platensis at 2.2a resolution
PDB Compounds: (G:) C-phycocyanin alpha chain

SCOPe Domain Sequences for d1ha7g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ha7g_ a.1.1.3 (G:) Phycocyanin alpha subunit {Spirulina platensis [TaxId: 118562]}
mktplteavsiadsqgrflssteiqvafgrfrqakagleaakaltskadslisgaaqavy
nkfpyttqmqgpnyaadqrgkdkcardigyylrmvtycliaggtgpmdeyliagideinr
tfelspswyiealkyikanhglsgdaateansyldyainals

SCOPe Domain Coordinates for d1ha7g_:

Click to download the PDB-style file with coordinates for d1ha7g_.
(The format of our PDB-style files is described here.)

Timeline for d1ha7g_: